General Information

  • ID:  hor005672
  • Uniprot ID:  Q9PW68
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  npy
  • Organism:  Typhlonectes natans (Rubber eel)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Expressed throughout the brain with highest levels of expression in medial pallium, basal forebrain, preoptic area, midbrain tegmentum and trigeminal nucleus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Typhlonectes (genus), Typhlonectidae (family), Gymnophiona (order), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SNPETMVSDVWWRESTENIPRSRFEDPSMW
  • Length:  30(68-97)
  • Propeptide:  MQGSMRLWLSVLTFTLSLLICLGTLADAYPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRYGKRSNPETMVSDVWWRESTENIPRSRFEDPSMW
  • Signal peptide:  MQGSMRLWLSVLTFTLSLLICLGTLADA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PW68-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005672_AF2.pdbhor005672_ESM.pdb

Physical Information

Mass: 418740 Formula: C160H234N44O52S2
Absent amino acids: ACGHKLQY Common amino acids: S
pI: 4.1 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 7
Hydrophobicity: -116.33 Boman Index: -9719
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 32.33
Instability Index: 7242 Extinction Coefficient cystines: 16500
Absorbance 280nm: 568.97

Literature

  • PubMed ID:  NA
  • Title:  NA